Transcript | Ll_transcript_220776 |
---|---|
CDS coordinates | 1-339 (+) |
Peptide sequence | YVDFIEQSWVVSFALVFNFLARSPAPFELCSLLATKLIYEPNFFLQLPKSHLRRVHKEFHQNNLEAVVATIAFGMGIDKPNVRRIIHYGWPQSLEAYYQEAGRAGRDGKLADC |
ORF Type | internal |
Blastp | ATP-dependent DNA helicase Q-like SIM from Arabidopsis with 80.6% of identity |
---|---|
Blastx | ATP-dependent DNA helicase Q-like SIM from Arabidopsis with 80.6% of identity |
Eggnog | atp-dependent dna helicase(COG0514) |
Kegg | Link to kegg annotations (AT5G27680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452258.1) |
Pfam | Helicase conserved C-terminal domain (PF00271.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer