Protein coding transcript 147264

• Transcript: Ll_transcript_220776
• CDS coordinates: 1-339 (+)
• Peptide sequence: YVDFIEQSWVVSFALVFNFLARSPAPFELCSLLATKLIYEPNFFLQLPKSHLRRVHKEFHQNNLEAVVATIAFGMGIDKPNVRRIIHYGWPQSLEAYYQEAGRAGRDGKLADC
• ORF Type: internal

Annotations of Ll_transcript_220776

• Blastp: ATP-dependent DNA helicase Q-like SIM from Arabidopsis with 80.6% of identity
• Blastx: ATP-dependent DNA helicase Q-like SIM from Arabidopsis with 80.6% of identity
• Eggnog: atp-dependent dna helicase(COG0514)
• Kegg: Link to kegg annotations (AT5G27680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452258.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;