Transcript | Ll_transcript_221082 |
---|---|
CDS coordinates | 136-609 (+) |
Peptide sequence | MSTSPKKITLKSSDGEAFEVDEAVAIESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCKKHVDAAASEDNKPNDEDLKAWDADFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE* |
ORF Type | complete |
Blastp | SKP1-like protein 1A from Arabidopsis with 82.39% of identity |
---|---|
Blastx | SKP1-like protein 1A from Arabidopsis with 82.39% of identity |
Eggnog | ubiquitin-dependent protein catabolic process(COG5201) |
Kegg | Link to kegg annotations (AT1G75950) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444820.1) |
Pfam | Skp1 family, tetramerisation domain (PF03931.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer