Protein coding transcript 147284

• Transcript: Ll_transcript_221087
• CDS coordinates: 2-613 (+)
• Peptide sequence: TVTQTLPINKAPTPSFIVNSITEKLGLGILQFSKGKSKKNLNLTNFTMTTPPKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYCKKHVEATSSEEKPNDEDLKAWDADFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_221087

• Blastp: SKP1-like protein 1A from Arabidopsis with 83.44% of identity
• Blastx: SKP1-like protein 1A from Arabidopsis with 83.44% of identity
• Eggnog: ubiquitin-dependent protein catabolic process(COG5201)
• Kegg: Link to kegg annotations (AT1G75950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421251.1)
• Pfam: Skp1 family, tetramerisation domain (PF03931.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;