Protein coding transcript 1474

• Transcript: Ll_transcript_329207
• CDS coordinates: 2-361 (+)
• Peptide sequence: KDVKKGIRRDRKYAVQPRNLFATGVHMSQNLQGKTTHKTEGLIKYFHYHGTIAERKESCTMFVNSTQVTYDKTPYELDTTMRDIASEIKKFEIKMIGSSVNKALRNNNQLSNLNFTRWG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_329207

• Blastp: Galactan beta-1,4-galactosyltransferase GALS2 from Arabidopsis with 63.92% of identity
• Blastx: Galactan beta-1,4-galactosyltransferase GALS2 from Arabidopsis with 63.92% of identity
• Eggnog: UPF0392 protein(ENOG410Z7P2)
• Kegg: Link to kegg annotations (AT5G44670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439312.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;