Protein coding transcript 147422

• Transcript: Ll_transcript_221170
• CDS coordinates: 3-407 (+)
• Peptide sequence: QHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAQVPLFFLLFIAHLCAHIFNFSSTQRSYLNHAFYEIENIWLLVVRPCSSDCTHANMCRSINKCRYKHVAVINVHKNNYKIAIPKKETDNIHRRLY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_221170

• Blastp: GTP-binding protein SAR1 from Nicotiana with 97.62% of identity
• Blastx: GTP-binding protein SAR1 from Nicotiana with 97.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440619.1)
• Pfam: ADP-ribosylation factor family (PF00025.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;