Protein coding transcript 147481

• Transcript: Ll_transcript_220911
• CDS coordinates: 279-740 (+)
• Peptide sequence: MELLLYNFMFDCFSWANWKFHIGFDVRAGVIISLASVYDLEKHKSRRVLYRGYISELFVPYQDPSEDWYYKTFFDAGEFGFGQSMVPLVPNLDCPPNAQFLDAHFAQVDGSPTTLKNAFCVFEQYGNIMWRHTETGIPNEDVIITITSIMIPT*
• ORF Type: complete

Annotations of Ll_transcript_220911

• Blastp: Primary amine oxidase from Lens with 77.52% of identity
• Blastx: Primary amine oxidase from Pisum with 80.25% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAB34918)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450683.1)
• Pfam: Copper amine oxidase, enzyme domain (PF01179.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;