Transcript | Ll_transcript_221095 |
---|---|
CDS coordinates | 371-934 (+) |
Peptide sequence | MKGHWVNGFGISCFSAFGDVIDPFVKKQVTSPMLLQDILDLAKYATVPVINGLTDYNHPCQIMADALTMIEHIGRLEGTKVVYVGDGNNIVHSWLLLASVVPFHFVCACPKGFEPDEKAVEKARQAGISKIEITNDPKEAVRGADVVYSDVWASMGQKEEAAYRRQVFKGFQVHNISQLEKIMFCRV* |
ORF Type | complete |
Blastp | Ornithine carbamoyltransferase, chloroplastic from Pisum with 92.03% of identity |
---|---|
Blastx | Ornithine carbamoyltransferase, chloroplastic from Pisum with 92.03% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458808.1) |
Pfam | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain (PF02729.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer