Protein coding transcript 147510

• Transcript: Ll_transcript_221098
• CDS coordinates: 155-1150 (+)
• Peptide sequence: MAAISSFSASFSVRSDKPSFSTSPSIFSSSHHFLPKFLHFPRIFVSPLPLQISCNASSTVSVQSTSPTAKTELKDFLHINDFDKDTILRILDRAIDVKALIKSGDRSFQPFKGKTMAMIFAKPSMRTRVSFETGFTLLGGHAIYLGPDDIQMGKREETRDVARVLCRYNDLLMARVFAHQDILDLAKYATVPVINGLTDYNHPCQIMADALTMIEHIGRLEGTKVVYVGDGNNIVHSWLLLASVVPFHFVCACPKGFEPDEKAVEKARQAGISKIEITNDPKEAVRGADVVYSDVWASMGQKEEAAYRRQVFKGFQVHNISQLEKIMFCRV*
• ORF Type: complete

Annotations of Ll_transcript_221098

• Blastp: Ornithine carbamoyltransferase, chloroplastic from Pisum with 83.96% of identity
• Blastx: Ornithine carbamoyltransferase, chloroplastic from Pisum with 84.76% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443211.1)
• Pfam: Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain (PF02729.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;