Protein coding transcript 1476

• Transcript: Ll_transcript_329147
• CDS coordinates: 2-475 (+)
• Peptide sequence: EMELAEKEKMKQKVEKIVSYKCNVFINRQLIYNYPEQLFADAGVMAIEHADFDGIERLALVTGGEIVSTFDNPENTKLGECDLIEEVIIGEDKLLRFAGVKMGEACSIVIRGATQQIVEEADRSLHDALCVLTTTVRDKKTVYGGGASEMIMARAVSE
• ORF Type: internal

Annotations of Ll_transcript_329147

• Blastp: T-complex protein 1 subunit beta from Caenorhabditis with 72.61% of identity
• Blastx: T-complex protein 1 subunit beta from Caenorhabditis with 72.61% of identity
• Eggnog: Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459)
• Kegg: Link to kegg annotations (CELE_T21B10.7)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413074.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;