Protein coding transcript 147690

• Transcript: Ll_transcript_221245
• CDS coordinates: 149-475 (+)
• Peptide sequence: MEERDPVISQAKRRQKMVASLPKLFNMIHLLLQSMKCSLIMKEELVGKIISSHRDIVDRREIEEQLNLLLVLVPDWISEKLTSSGDILFSINKTLNPGTIRASLEQAK*
• ORF Type: complete

Annotations of Ll_transcript_221245

• Blastp: CDT1-like protein a, chloroplastic from Arabidopsis with 59.43% of identity
• Blastx: CDT1-like protein a, chloroplastic from Arabidopsis with 58.77% of identity
• Eggnog: Chromatin licensing and DNA replication factor 1(ENOG410XT37)
• Kegg: Link to kegg annotations (AT2G31270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459716.1)
• Pfam: DNA replication factor Cdt1 C-terminal domain (PF16679.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;