Transcript | Ll_transcript_221245 |
---|---|
CDS coordinates | 149-475 (+) |
Peptide sequence | MEERDPVISQAKRRQKMVASLPKLFNMIHLLLQSMKCSLIMKEELVGKIISSHRDIVDRREIEEQLNLLLVLVPDWISEKLTSSGDILFSINKTLNPGTIRASLEQAK* |
ORF Type | complete |
Blastp | CDT1-like protein a, chloroplastic from Arabidopsis with 59.43% of identity |
---|---|
Blastx | CDT1-like protein a, chloroplastic from Arabidopsis with 58.77% of identity |
Eggnog | Chromatin licensing and DNA replication factor 1(ENOG410XT37) |
Kegg | Link to kegg annotations (AT2G31270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459716.1) |
Pfam | DNA replication factor Cdt1 C-terminal domain (PF16679.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer