Transcript | Ll_transcript_221020 |
---|---|
CDS coordinates | 2446-3072 (+) |
Peptide sequence | MEIQVNGGTIAQKVDYAYNFFEKQIPVNAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKVYKVGKSGEESHTAITEFDRTEKDITPMGGFPHYGVVNHDYLMVKGGCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFVDTSSKFGHGRFQTTEEKQKFYGRVKA* |
ORF Type | complete |
Blastp | 60S ribosomal protein L3 from Oryza sativa with 89.42% of identity |
---|---|
Blastx | 60S ribosomal protein L3 from Oryza sativa with 85.23% of identity |
Eggnog | One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit (By similarity)(COG0087) |
Kegg | Link to kegg annotations (4351604) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434008.1) |
Pfam | Ribosomal protein L3 (PF00297.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer