Protein coding transcript 147749

• Transcript: Ll_transcript_220806
• CDS coordinates: 997-1440 (+)
• Peptide sequence: MKFTFSKNQTFLIQNPLLTFPGSQDYTAFCLTVIQTNEDYGTIGQDFLKGYRMVFDRENLRFGWSSSNCQDSMGDTENLTSASHSGSPNSLPANQQQTIPNTPAVPPAVAGKTSPKPSIVTASRHTSWHLLSSLSLIFIYGYLVKLM*
• ORF Type: complete

Annotations of Ll_transcript_220806

• Blastp: Aspartic proteinase-like protein 1 from Arabidopsis with 45.54% of identity
• Blastx: Aspartic proteinase-like protein 1 from Arabidopsis with 52.99% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT5G10080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456918.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;