Protein coding transcript 147780

• Transcript: Ll_transcript_221064
• CDS coordinates: 242-892 (+)
• Peptide sequence: MALQMTWQPSLLSDKRKTGPPLGLRNLGNSCYLNSVLQCLTYTPPLANFCLRFQHSSLCDSAAASSCPFCILEKQIARSLRVDLTHDAPSKIQNCLRIFAEHFRCGRQEDAHEFLRYVIDACHNTCLRLKKLRRKGGVGDGVGGSGGGGSSVVKEIFGGALQSQVKCLNCGYESNKADEIMDISLDVFHSSSLRDSMQKFFQAEVLDGNNKYKCDR*
• ORF Type: complete

Annotations of Ll_transcript_221064

• Blastp: Ubiquitin carboxyl-terminal hydrolase 25 from Arabidopsis with 71.89% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 25 from Arabidopsis with 71.89% of identity
• Eggnog: ubiquitin carboxyl-terminal hydrolase(ENOG410XQ92)
• Kegg: Link to kegg annotations (AT3G14400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456425.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF13423.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;