Protein coding transcript 1478

• Transcript: Ll_transcript_329151
• CDS coordinates: 160-492 (+)
• Peptide sequence: MESEEPATPLDLDGGDTASGDEGLAAIGGGGSRDRVKGPWSPEEDAILSRLVSKFGARNWSLIARGISGRSGKSCRLRWCNQLDPVVKRKPFTSMFLSFRLNLLIVFLFL*
• ORF Type: complete

Annotations of Ll_transcript_329151

• Blastp: Transcription factor MYB25 from Arabidopsis with 68.18% of identity
• Blastx: Transcription factor MYB25 from Arabidopsis with 70.49% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT2G39880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434223.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;