Protein coding transcript 147908

• Transcript: Ll_transcript_173851
• CDS coordinates: 3-482 (+)
• Peptide sequence: KREILKSLCSDNRGMLRMAKLSKPFWGEAIQTTCYLINRSPSVPLGFDIPERVWSGHDIKYSHLKVFGCKAFSHVSKEQRQKLDDRAIPCIFPGYGDEEFGYRLWDPEKKRVIRNRDIVFHEQETVSDFVTLEKTKIPGGNVDFTPVSLPRENAIGGES*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_173851

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 60.51% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 60.51% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963654.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;