Protein coding transcript 148

• Transcript: Ll_transcript_277460
• CDS coordinates: 3-434 (+)
• Peptide sequence: VVLYEMLYGTTPFTGSNRHQTFHSILTKEPELTGMKTALRDLIRRLLEKDPGRRIKVHEIKGHDFFKGVKWDMVLEIARPPYIPHTRSDEVKDIVGFSQKDVELFVHQIYFPNSAIDSDHKKEDEDNHMLSHSQTEKEDFATF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_277460

• Blastp: Serine/threonine-protein kinase OXI1 from Arabidopsis with 55.47% of identity
• Blastx: Serine/threonine-protein kinase OXI1 from Arabidopsis with 55.47% of identity
• Eggnog: serine threonine-protein kinase(ENOG410XQ0C)
• Kegg: Link to kegg annotations (AT3G25250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427346.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;