Protein coding transcript 148117

• Transcript: Ll_transcript_173875
• CDS coordinates: 1488-1838 (+)
• Peptide sequence: MRLSWALVHSRKKEDVQRGIAMLETSLGNDKSPLHQREKIYLLAVGYYRSNDYGRSRELLGQCLEVAPDWRQAQSLNKIVEDRIAKGIANVMSFDADGVIGIGITATGVALIVGGIA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_173875

• Blastp: Mitochondrial fission 1 protein A from Arabidopsis with 62.18% of identity
• Blastx: Mitochondrial fission 1 protein A from Arabidopsis with 62.16% of identity
• Eggnog: fission 1(ENOG4111PPH)
• Kegg: Link to kegg annotations (AT3G57090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437054.1)
• Pfam: Fis1 N-terminal tetratricopeptide repeat (PF14852.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;