Transcript | Ll_transcript_173881 |
---|---|
CDS coordinates | 140-643 (+) |
Peptide sequence | MDAKIGSFFESIGNFFTGGEQIPWCDGDVIAGCEREVAEASNGDSEERKNESIMRLSWALVHSRKKEDVQRGIAMLETSLGNDKSPLHQREKIYLLAVGYYRSNDYGRSRELLGQCLEVAPDWRQAQSLNKIVEDRIAKDGVIGIGITATGVALIVGGIAAALARKN* |
ORF Type | complete |
Blastp | Mitochondrial fission 1 protein A from Arabidopsis with 65.88% of identity |
---|---|
Blastx | Mitochondrial fission 1 protein A from Arabidopsis with 65.71% of identity |
Eggnog | fission 1(ENOG4111PPH) |
Kegg | Link to kegg annotations (AT3G57090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437054.1) |
Pfam | Fis1 N-terminal tetratricopeptide repeat (PF14852.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer