Protein coding transcript 14813

• Transcript: Ll_transcript_469599
• CDS coordinates: 2-388 (+)
• Peptide sequence: KKELKDSLEKLGMMIPDKELTQMIEKIDVNGDGWVDMEEFGELYESIMEEHDEEEDMREAFNVFDHNRDGFITVEELRTVLSSLGLKQGRTVEECKKMIMKVDVDGDGMVNYKEFKQMMKGGGFSALG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_469599

• Blastp: Calmodulin-like protein 3 from Arabidopsis with 82.03% of identity
• Blastx: Calmodulin-like protein 3 from Arabidopsis with 82.03% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT3G07490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448581.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;