Protein coding transcript 148290

• Transcript: Ll_transcript_173313
• CDS coordinates: 146-568 (+)
• Peptide sequence: MEHCLASTCIMPLSFNFNNSKRTILFPTTTLTKSKPLLSLVNASNTKRNTLSSNWLVSNDDFSSLSTASPWLPTLQQLDTTNMLLRQRIIFLGSQVDDVTADYIISQLLFLDAEDPKKDITLFINSPGGSVTAGMPIKFY*
• ORF Type: complete

Annotations of Ll_transcript_173313

• Blastp: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic from Arabidopsis with 55.73% of identity
• Blastx: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic from Arabidopsis with 85.42% of identity
• Eggnog: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity)(COG0740)
• Kegg: Link to kegg annotations (AT1G66670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453049.1)
• Pfam: Clp protease (PF00574.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;