| Transcript | Ll_transcript_173945 |
|---|---|
| CDS coordinates | 202-540 (+) |
| Peptide sequence | MPCLYITTNLNLDGVNTDLVFSEATTAVSKIIGKPEKFVMVILKSSVPISFEGNKEPAAYGEIVSMGGINKEVKRNLISTIGKILHSNLSIPRTRFFLKVFDTTAFSTNSKI* |
| ORF Type | complete |
| Blastp | Macrophage migration inhibitory factor homolog from Trichuris with 29.41% of identity |
|---|---|
| Blastx | Macrophage migration inhibitory factor homolog from Trichuris with 29.41% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019412944.1) |
| Pfam | Macrophage migration inhibitory factor (MIF) (PF01187.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer