Transcript | Ll_transcript_173945 |
---|---|
CDS coordinates | 202-540 (+) |
Peptide sequence | MPCLYITTNLNLDGVNTDLVFSEATTAVSKIIGKPEKFVMVILKSSVPISFEGNKEPAAYGEIVSMGGINKEVKRNLISTIGKILHSNLSIPRTRFFLKVFDTTAFSTNSKI* |
ORF Type | complete |
Blastp | Macrophage migration inhibitory factor homolog from Trichuris with 29.41% of identity |
---|---|
Blastx | Macrophage migration inhibitory factor homolog from Trichuris with 29.41% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019412944.1) |
Pfam | Macrophage migration inhibitory factor (MIF) (PF01187.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer