Protein coding transcript 148347

• Transcript: Ll_transcript_173412
• CDS coordinates: 202-729 (+)
• Peptide sequence: MAHRRMEMCLVLVIVTMLCAGAAAQSSCVNTLVSLSPCLNYITGNSSTPSSGCCSQLASVVSSSPQCLCQVLNGGVSSLGININQTQALTLPAACKVQTPPTSQCNAASPANTPAGPAADTPAEADSPNSVPSSGTGSKTVPTTEGGASGGNSIKLSIPLFLILAAAYTSTFSTY*
• ORF Type: complete

Annotations of Ll_transcript_173412

• Blastp: Non-specific lipid transfer protein GPI-anchored 2 from Arabidopsis with 36.51% of identity
• Blastx: Non-specific lipid transfer protein GPI-anchored 2 from Arabidopsis with 33.95% of identity
• Eggnog: lipid-transfer protein-like protein(ENOG410YY93)
• Kegg: Link to kegg annotations (AT3G43720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444576.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;