Protein coding transcript 1484

• Transcript: Ll_transcript_329154
• CDS coordinates: 211-750 (+)
• Peptide sequence: MGQPMKNITSSSFRLRSPSLNSLRLRRIFDMFDKNGDSMITIKEISQALNLLGLDADLTELEAITRSFIKPGNEGLTYEDFVALHESLGDTYFGIGDVEENEEQEESDLREAFKVFDENGDGYICAKELQAVLGKLGLNEGNEIDRVNKMIVSFDTNHDGRVDFSEFKNMMRNTLITTS*
• ORF Type: complete

Annotations of Ll_transcript_329154

• Blastp: Calcium-binding protein CML42 from Arabidopsis with 61.58% of identity
• Blastx: Calcium-binding protein CML42 from Arabidopsis with 58.49% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT4G20780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464989.1)
• Pfam: EF-hand domain (PF13405.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;