Protein coding transcript 148445

• Transcript: Ll_transcript_174073
• CDS coordinates: 2-1009 (+)
• Peptide sequence: LKEEIPQILQTHGNSIAGRQMRKPDLMVGKDKMNNNNIKINSNNIKIKLRKGLWSPEEDEKLLRYMISKGQGCWSDIARNAGLQRCGKSCRLRWINYLRPDLKRGAFSPQEEDLIIHLHSILGNRWSQIAARLPGRTDNEIKNFWNSTIKKRLKTDNKSDSSEHRDHVLGCENGIMPINELMTMYMDSSSTTSSSMQSMHAMVLSHDQFDPFPMLTNPYDMSSCLAKVEMVDGLHGDYGILESNKMGLESDLSLPSLESRSIENENNSVPIDVKSHNNHFNNTCFNNTEQIQNSNVEELFGFGNHGQGENLRMGEWDLESLMQDISYFPSSDFQF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_174073

• Blastp: Transcription factor MYB83 from Arabidopsis with 46.86% of identity
• Blastx: Transcription factor MYB83 from Arabidopsis with 79.1% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G08500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424980.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;