Protein coding transcript 148461

• Transcript: Ll_transcript_174089
• CDS coordinates: 151-555 (+)
• Peptide sequence: MSSMSSGSDSRKRSKGRRSSSPVEEAGEDSQGPLKKGPWTSSEDDILSEYVKQHGEGNWNAVQKHSGLARCGKSCRLRWANHLRPDLRKGAFSPEEEQRIIELHARMGNKWARMAAELPGRTDNEIKHFWNSTLK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_174089

• Blastp: Transcription factor MYB101 from Arabidopsis with 75.49% of identity
• Blastx: Transcription factor MYB101 from Arabidopsis with 75.49% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT2G32460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426782.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;