Protein coding transcript 148487

• Transcript: Ll_transcript_174294
• CDS coordinates: 88-591 (+)
• Peptide sequence: MFYCFAGQIELYSHVPVLRNFVEHLKRKNFNVCAVYLLDSQFMTDVTKFISGCMACLSAMVQLELPHVNILSKMDLVTNKKDVEEFLDPEPTFLLSELNQRMAPQFAKLNKSLIELVNNYSMVSFIPLDLRKERSIQYVLAQIDNCIQYGEDADVKVKDFDQDDDDE*
• ORF Type: complete

Annotations of Ll_transcript_174294

• Blastp: GPN-loop GTPase 3 from Ustilago with 45.61% of identity
• Blastx: GPN-loop GTPase 3 from Ustilago with 45.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (UMAG_01243)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449856.1)
• Pfam: Conserved hypothetical ATP binding protein (PF03029.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;