Protein coding transcript 148493

• Transcript: Ll_transcript_174286
• CDS coordinates: 88-585 (+)
• Peptide sequence: MFYCFAGQIELYSHVPVLRNFVEHLKRKNFNVCAVYLLDSQFMTDVTKFISGCMACLSAMVQLELPHVNILSKMDLVTNKKDVEEFLDPEPTFLLSELNQRMAPQFAKLNKSLIELVNNYSMVSFIPLDLRKERRWTTWLRFGATSPRCPRRGHGELVRDNTPSLG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_174286

• Blastp: GPN-loop GTPase 3 from Kluyveromyces with 46.58% of identity
• Blastx: GPN-loop GTPase 3 from Kluyveromyces with 46.26% of identity
• Eggnog: GPN-loop GTPase 3(ENOG410XPBZ)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449856.1)
• Pfam: Conserved hypothetical ATP binding protein (PF03029.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;