Protein coding transcript 148495

• Transcript: Ll_transcript_174288
• CDS coordinates: 309-608 (+)
• Peptide sequence: MGYAQLVIGPAGSGKSTYCSSLYEHCVATRRTIHIVNLDPAAENFDYPVAMDIRELISLDDVMEELGLGPNGGLVYCMEYPFHQFLKLLYCLSFESSLN*
• ORF Type: complete

Annotations of Ll_transcript_174288

• Blastp: GPN-loop GTPase 3 from Xenopus with 66.3% of identity
• Blastx: GPN-loop GTPase 3 from Debaryomyces with 48.5% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (734520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449856.1)
• Pfam: Conserved hypothetical ATP binding protein (PF03029.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;