Protein coding transcript 148602

• Transcript: Ll_transcript_174517
• CDS coordinates: 27-530 (+)
• Peptide sequence: MVMALHYLIMAIPVTLFVVVNATPIPPSSQAQQIHDKVHKLPGQNFTINFDHYSGYVTVDQKAGRALFYWFIESDQSPQTKPLLLWFNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYRNPYSWNQVANILFVDSPAGVGFSYSNTSSDIQNNGDKKTGNTSTILHLNH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_174517

• Blastp: Serine carboxypeptidase-like 29 from Arabidopsis with 66.41% of identity
• Blastx: Serine carboxypeptidase-like 29 from Arabidopsis with 66.41% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT4G30810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453690.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;