Protein coding transcript 148622

• Transcript: Ll_transcript_173681
• CDS coordinates: 3-380 (+)
• Peptide sequence: SLEKQFETFRTELEESGTLRDRIRSVVSEIESTTRVMYATLLLVHQSRSIDELLEKAKSQIDVLKEKYKQLAQILGGCSGQYYRYHGDWKSETQSVVSLLTFMHWLETGSLLEHKEAEDKLGCMY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_173681

• Blastp: Translin from Gallus with 27.07% of identity
• Blastx: Translin from Gallus with 54.08% of identity
• Eggnog: Translin(ENOG410XR87)
• Kegg: Link to kegg annotations (395955)
• CantataDB: Link to cantataDB annotations (CNT0001613)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444323.1)
• Pfam: Translin family (PF01997.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;