Protein coding transcript 148661

• Transcript: Ll_transcript_174384
• CDS coordinates: 3-890 (+)
• Peptide sequence: NNICFWTNNFFVQNFSEYNMWLAAENGMFLRLTTGEWMTTMPENLTMDWVDSVKHVFEYFTERTPRSHFEVRETSVIWNYKYADVEFGRLQARDLLQHLWTGPISNASLDVVQGARSVEVRAVGVSKGAAIDRILGEIVHHKGMKAPIDYVLCIGHFLAKDEDVYKFFEPELPSESLPTAGALHSTSQRPSSLPKSSSSRVASGSKAFRYKKQRSLSIIERREIEYASGDPWRPWRPSDRISLHEGSSVLDLKGDNYFSCAVARKRSSARYLLKTSDDVVDLLSDLADHSSLPST*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_174384

• Blastp: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 63.51% of identity
• Blastx: Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 from Arabidopsis with 63.5% of identity
• Eggnog: synthase(COG0380)
• Kegg: Link to kegg annotations (AT1G78580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461331.1)
• Pfam: Trehalose-phosphatase (PF02358.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;