Transcript | Ll_transcript_29622 |
---|---|
CDS coordinates | 671-1147 (+) |
Peptide sequence | MRGQKSRSGPGVRPGFEGGQMPLYRRIPKLRGIAGGMRAGLPKYVHVNLRDIEPRFQDGEEVSLETLKEKRIINPSGRDRKLPLKILGHGELTKKLTIKARAYSASAKEKLETLGCSLTVLPGRKKWVKPSVAKNLARADEYFAKKRAAAAAAEQASA* |
ORF Type | complete |
Blastp | 50S ribosomal protein L15, chloroplastic from Pisum with 81.53% of identity |
---|---|
Blastx | 50S ribosomal protein L15, chloroplastic from Pisum with 75.89% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452494.1) |
Pfam | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A (PF00828.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer