Protein coding transcript 148681

• Transcript: Ll_transcript_28803
• CDS coordinates: 202-813 (+)
• Peptide sequence: MAEDSSSAKSYHHHRSFSSYSSSSSTQNSVYLDAETSGTKTDIATTSSGDIGRNSTTPIVQEPMDLAEPTNQGHLLNAAKVTKNNRISALASKFFDEKVPLKKRLRWLKRASMVKDDGTVEFEVPGDIKHHSLDYRTGVTDNDVQDEESDEAILVHNIRPLQIAMLIVGTRGDVQPFVAIAKRLQVFHIPDFFSIFLCNDHLL*
• ORF Type: complete

Annotations of Ll_transcript_28803

• Blastp: Sterol 3-beta-glucosyltransferase UGT80A2 from Arabidopsis with 46.67% of identity
• Blastx: Sterol 3-beta-glucosyltransferase UGT80A2 from Arabidopsis with 46.67% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT3G07020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462367.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;