Transcript | Ll_transcript_28814 |
---|---|
CDS coordinates | 430-1272 (+) |
Peptide sequence | MVKNKGFLPSGPSEIHIQRNQIKAIINSLLPACNEPDPDSNIPFRAEAIIANPPAYGHTHVAEYLKVPLHIFFTMPWTPTSEFPHPLSRVKQHVGYRWSYQVVDALIWLGIRDLINEFRKKKLKRRPISYLSGSYTSLPDVPYGYIWSPHLVPKPKDWGPKIDVVGFCFLDLATNYEPPKSLVEWLEEGEKPIYVGFGSLPLQDPEKMTKIIVEALDKTGQRGIINKGWGGLGNLAEPKKSVYLLDNCPHDWLFPRCTAVVPAKFSQLKYNCFELQLKFR* |
ORF Type | complete |
Blastp | Sterol 3-beta-glucosyltransferase UGT80A2 from Arabidopsis with 79.69% of identity |
---|---|
Blastx | Sterol 3-beta-glucosyltransferase UGT80A2 from Arabidopsis with 81.06% of identity |
Eggnog | Transferase(COG1819) |
Kegg | Link to kegg annotations (AT3G07020) |
CantataDB | Link to cantataDB annotations (CNT0002803) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462367.1) |
Pfam | Glycosyltransferase family 28 N-terminal domain (PF03033.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer