Protein coding transcript 148688

• Transcript: Ll_transcript_28814
• CDS coordinates: 430-1272 (+)
• Peptide sequence: MVKNKGFLPSGPSEIHIQRNQIKAIINSLLPACNEPDPDSNIPFRAEAIIANPPAYGHTHVAEYLKVPLHIFFTMPWTPTSEFPHPLSRVKQHVGYRWSYQVVDALIWLGIRDLINEFRKKKLKRRPISYLSGSYTSLPDVPYGYIWSPHLVPKPKDWGPKIDVVGFCFLDLATNYEPPKSLVEWLEEGEKPIYVGFGSLPLQDPEKMTKIIVEALDKTGQRGIINKGWGGLGNLAEPKKSVYLLDNCPHDWLFPRCTAVVPAKFSQLKYNCFELQLKFR*
• ORF Type: complete

Annotations of Ll_transcript_28814

• Blastp: Sterol 3-beta-glucosyltransferase UGT80A2 from Arabidopsis with 79.69% of identity
• Blastx: Sterol 3-beta-glucosyltransferase UGT80A2 from Arabidopsis with 81.06% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT3G07020)
• CantataDB: Link to cantataDB annotations (CNT0002803)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462367.1)
• Pfam: Glycosyltransferase family 28 N-terminal domain (PF03033.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;