Protein coding transcript 14869

• Transcript: Ll_transcript_426588
• CDS coordinates: 1346-1948 (+)
• Peptide sequence: MVASLQYGTRCPCGYCHISDVEHHKQEDHMESFFLAETVKYLWLLFDLAVGPANLVENGPYKYIFSTEGHLLPATPQISLVREHCLYHGAYCRSGDQRQTHFMSEADNDKQESNDSISYESWSKATYSSDYTTFKPTGVSGLIKGVCPGLNHGQKFGISYVHSADEHRDYEVIHQKESTNVQSHSVMVLPSQSSNQLISD*
• ORF Type: complete

Annotations of Ll_transcript_426588

• Blastp: Alpha-mannosidase I MNS4 from Arabidopsis with 56.7% of identity
• Blastx: Alpha-mannosidase I MNS4 from Arabidopsis with 62.45% of identity
• Eggnog: ER degradation enhancer, mannosidase alpha-like(ENOG410XS6F)
• Kegg: Link to kegg annotations (AT5G43710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428634.1)
• Pfam: Glycosyl hydrolase family 47 (PF01532.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;