Transcript | Ll_transcript_29807 |
---|---|
CDS coordinates | 1199-1768 (+) |
Peptide sequence | MISFLDVSYCIKIGASALEIIGKNCKLLEGLCRNMHPLDTAGKPLQDDEAYAIATTMPKLKHLELAYNLISTCGVLKILSYCPKLEFLDQRGCWGVTLDNMFVKQKYPKLKVLGPFVLDTYGNDAWDDYSDISDSSEWDFVDGGMGEYDVVDSDSDDGMWDDEGRLDDELQFRFYEGIEDAGMYWPPSP* |
ORF Type | complete |
Blastp | F-box protein FBW2 from Arabidopsis with 51.52% of identity |
---|---|
Blastx | F-box protein FBW2 from Arabidopsis with 46.21% of identity |
Eggnog | NA(ENOG410YQ9V) |
Kegg | Link to kegg annotations (AT4G08980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417876.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer