Protein coding transcript 14879

• Transcript: Ll_transcript_426118
• CDS coordinates: 2-613 (+)
• Peptide sequence: NEKSKRKDRFNYKERCENMIDYIKRLKACIRWFQDLELSYSLEQERLKNSLELAQQKCMEMELLLKIKEEELNSIIVEMRRNCTSLQEKLKQEETQKTVAVEYLVKERDARLNYERSQSTLEEDLGRAQRELHSANEKISSLNDMYKRLQDYVTGLQQYNGKLHSELSNVEDELKRIEKEKANVVESLAMLRGQLALSMVSLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_426118

• Blastp: Kinesin-like protein KIN-14N from Arabidopsis with 53.57% of identity
• Blastx: Kinesin-like protein KIN-14N from Arabidopsis with 53.57% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT5G54670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458784.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;