Protein coding transcript 148805

• Transcript: Ll_transcript_28957
• CDS coordinates: 582-947 (+)
• Peptide sequence: METEDNNNRVRIFVGGLGETVTPEDLNRLFSSLGTVHGIQTIRTKGRSFAYVGFFPSPTYSKSLSKLFSKYNGCLWKGEKMKLEKTKENYLVRLKKRMAKKTIYREDLCKCFLLLCWEMPS*
• ORF Type: complete

Annotations of Ll_transcript_28957

• Blastp: Nucleolar protein 8 from Mus with 31.31% of identity
• Blastx: ATP synthase subunit d, mitochondrial from Arabidopsis with 61.86% of identity
• Eggnog: nucleolar protein 8(ENOG410Y5CN)
• Kegg: Link to kegg annotations (70930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416983.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;