Protein coding transcript 148809

• Transcript: Ll_transcript_28963
• CDS coordinates: 3-365 (+)
• Peptide sequence: KTKMSGTVKKVSDIAFKAGKTIDWDGMAKLLVSDEARKEFSNLRRAFDEVNSQLQTKFNQEPEPIDWDYYRKGIGNRLVDMYKEHYDKIYVHIGEPFWFYFNKSRYCFLLRRKQILEIKF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_28963

• Blastp: ATP synthase subunit d, mitochondrial from Arabidopsis with 77.27% of identity
• Blastx: ATP synthase subunit d, mitochondrial from Arabidopsis with 77.27% of identity
• Eggnog: energy coupled proton transport, down electrochemical gradient(ENOG4111IHJ)
• Kegg: Link to kegg annotations (AT3G52300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427572.1)
• Pfam: ATP synthase D chain, mitochondrial (ATP5H) (PF05873.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;