Protein coding transcript 148825

• Transcript: Ll_transcript_28408
• CDS coordinates: 2-427 (+)
• Peptide sequence: GSRPEHLKEGFFIEPTIISAVTTSMQIWREEVFGPVLCVKTFSTEEEAIDLANDTIYGLGSAVLSNDLERCERLSKAFKAGIVWVNCSQPCFTEAPWGGNKRSGFGRELGEWGLDNYLSVKQVTQYISDEAWGWYQNPSKL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_28408

• Blastp: Betaine aldehyde dehydrogenase 2, mitochondrial from Arabidopsis with 82.27% of identity
• Blastx: Betaine aldehyde dehydrogenase 2, mitochondrial from Arabidopsis with 82.27% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT3G48170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463492.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;