Transcript | Ll_transcript_28417 |
---|---|
CDS coordinates | 2-427 (+) |
Peptide sequence | GSRPEHLKEGFFIEPTIISAVTTSMQIWREEVFGPVLCVKTFSTEEEAIDLANDTIYGLGSAVLSNDLERCERLSKAFKAGIVWVNCSQPCFTEAPWGGNKRSGFGRELGEWGLDNYLSVKQVTQYISDEAWGWYQNPSKL* |
ORF Type | 5prime_partial |
Blastp | Betaine aldehyde dehydrogenase 2, mitochondrial from Arabidopsis with 82.27% of identity |
---|---|
Blastx | Betaine aldehyde dehydrogenase 2, mitochondrial from Arabidopsis with 82.27% of identity |
Eggnog | Dehydrogenase(COG1012) |
Kegg | Link to kegg annotations (AT3G48170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463492.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer