Transcript | Ll_transcript_29198 |
---|---|
CDS coordinates | 80-661 (+) |
Peptide sequence | MKASILAQINHFGQTPKQLFLKPHVKRRTDRKLPPHPLKYSSHLVPHEIRRSSSPITQIVTFNDKILIAGSNNLLKPSTYSKYVAWSFPDRSLRFISYEQDRLLSTHENLHGSNQIQCIGVSHDGRVLVSGADDGLVNVWRVSKFGPRALRRLKLEKGLCGHTARITCLQVSQPYMLIVSGSDDCTVIIWDLSS |
ORF Type | 3prime_partial |
Blastp | Protein SPIRRIG from Arabidopsis with 77.32% of identity |
---|---|
Blastx | Protein SPIRRIG from Arabidopsis with 78.18% of identity |
Eggnog | beige BEACH domain containing protein(ENOG410XNQC) |
Kegg | Link to kegg annotations (AT1G03060) |
CantataDB | Link to cantataDB annotations (CNT0002534) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441894.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer