Protein coding transcript 148868

• Transcript: Ll_transcript_29198
• CDS coordinates: 80-661 (+)
• Peptide sequence: MKASILAQINHFGQTPKQLFLKPHVKRRTDRKLPPHPLKYSSHLVPHEIRRSSSPITQIVTFNDKILIAGSNNLLKPSTYSKYVAWSFPDRSLRFISYEQDRLLSTHENLHGSNQIQCIGVSHDGRVLVSGADDGLVNVWRVSKFGPRALRRLKLEKGLCGHTARITCLQVSQPYMLIVSGSDDCTVIIWDLSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_29198

• Blastp: Protein SPIRRIG from Arabidopsis with 77.32% of identity
• Blastx: Protein SPIRRIG from Arabidopsis with 78.18% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT1G03060)
• CantataDB: Link to cantataDB annotations (CNT0002534)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441894.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;