Protein coding transcript 148882

• Transcript: Ll_transcript_29570
• CDS coordinates: 1484-1909 (+)
• Peptide sequence: MTDEIFGPLLPIITVDKVEESFDIINSGPKPLAAYLFTNKKALKEKFVATISAGGLVINDTTLHLAVHTLPFGGIGDSGVGAYHGKFSFDAFSHKKAVLYRSFIGDASVRYPPYTNTSSRLLKAILGEGILGVIRVVFGWS*
• ORF Type: complete

Annotations of Ll_transcript_29570

• Blastp: Aldehyde dehydrogenase family 3 member H1 from Arabidopsis with 66.91% of identity
• Blastx: Aldehyde dehydrogenase family 3 member H1 from Arabidopsis with 71.02% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT1G44170)
• CantataDB: Link to cantataDB annotations (CNT0002218)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460554.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;