Protein coding transcript 148883

• Transcript: Ll_transcript_29571
• CDS coordinates: 922-1482 (+)
• Peptide sequence: MLAWKIYYNVGFIGNGRVGRIVMAAAVKHLTPVVLELGGKSPVVVDSNINLEVAARRIIAGKWCCNSGQACVSPDYIITTKDYAPKLVDALKSELDKFYGKNPLESKDLSRIVNSNHFARLTKLLDDDKVSGKIACGGEKDENKLRIAPTVLLDVPRDSLIMTDEIFGPLLPIITVGIKTPGHILL*
• ORF Type: complete

Annotations of Ll_transcript_29571

• Blastp: Aldehyde dehydrogenase family 3 member H1 from Arabidopsis with 72.09% of identity
• Blastx: Aldehyde dehydrogenase family 3 member H1 from Arabidopsis with 61.64% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT1G44170)
• CantataDB: Link to cantataDB annotations (CNT0002218)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004498346.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;