Protein coding transcript 148890

• Transcript: Ll_transcript_29565
• CDS coordinates: 852-1433 (+)
• Peptide sequence: MAAAAKHLTPVVLELGGKSPVVVDSNINLKVATRRIIAGKWGSNNGQACISPDYIITTKEYAPKLVDALKTELEAFYGKNPLDSKDLSRIVNSNHFARLTKLLDDDKVSGKIVYGGEKDESKLRIAPTVLLDIPRDSLIMSEEIFGPLLPIITVDKLEESFDVINSAPKPLAAYIFTNNKALKEQFVTTVSAGG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_29565

• Blastp: Aldehyde dehydrogenase family 3 member H1 from Arabidopsis with 78.87% of identity
• Blastx: Aldehyde dehydrogenase family 3 member H1 from Arabidopsis with 78.31% of identity
• Eggnog: Dehydrogenase(COG1012)
• Kegg: Link to kegg annotations (AT1G44170)
• CantataDB: Link to cantataDB annotations (CNT0002218)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460554.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;