Protein coding transcript 1490

• Transcript: Ll_transcript_425658
• CDS coordinates: 97-411 (+)
• Peptide sequence: MVKTNGNVLVQWLVAALLVALLGGAKAVVLCNMDSTKLNLCYAAVTGTHPPKPNAKCCEVILHADLPCLCGYKSILPALGINPTNAMTLPKRCGLKTPPQCRVN*
• ORF Type: complete

Annotations of Ll_transcript_425658

• Blastp: Putative lipid-transfer protein DIR1 from Arabidopsis with 42.17% of identity
• Blastx: Putative lipid-transfer protein DIR1 from Arabidopsis with 43.84% of identity
• Eggnog: Lipid-transfer protein(ENOG410YXDY)
• Kegg: Link to kegg annotations (AT5G48485)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447110.1)
• Pfam: Probable lipid transfer (PF14368.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;