Transcript | Ll_transcript_29342 |
---|---|
CDS coordinates | 234-878 (+) |
Peptide sequence | MGNPRMLVFFFIAFITVAQSLPFIVLHGIGDKCRHQGINHFIELLSDWSESQGYCIEVGNGSWDSWTMPLTEQTAIACEKVKKISDLRQGYNIVGLSQGNLIARGIIEFCDGGPPVNNFVSLGGPHAGTASVPLCGSELVCKFVDAIIELEVYSSIVQAHVAPSGYVKIPTDIAGYISGCKFLPKLNNEIISERNSTYRKRFSSLQNLVLIMVG* |
ORF Type | complete |
Blastp | Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 from Schizosaccharomyces with 27% of identity |
---|---|
Blastx | Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 from Schizosaccharomyces with 26.61% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC530.12c) |
CantataDB | Link to cantataDB annotations (CNT0000189) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461081.1) |
Pfam | Palmitoyl protein thioesterase (PF02089.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer