Protein coding transcript 149023

• Transcript: Ll_transcript_29343
• CDS coordinates: 234-971 (+)
• Peptide sequence: MGNPRMLVFFFIAFITVAQSLPFIVLHGIGDKCRHQGINHFIELLSDWSESQGYCIEVGNGSWDSWTMPLTEQTAIACEKVKKISDLRQGYNIVGLSQGNLIARGIIEFCDGGPPVNNFVSLGGPHAGTASVPLCGSELVCKFVDAIIELEVYSSIVQAHVAPSGYVKIPTDIAGYISGCKFLPKLNNEIISERNSTYRKRFSSLQNLVLIMFENDTIIIPKETAWFGYYPDGAFHPVLTPQQVI*
• ORF Type: complete

Annotations of Ll_transcript_29343

• Blastp: Palmitoyl-protein thioesterase 1 from Caenorhabditis with 30.47% of identity
• Blastx: Palmitoyl-protein thioesterase 1 from Caenorhabditis with 30.47% of identity
• Eggnog: Triacylglycerol Lipase(COG1075)
• Kegg: Link to kegg annotations (CELE_F44C4.5)
• CantataDB: Link to cantataDB annotations (CNT0000189)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461081.1)
• Pfam: Palmitoyl protein thioesterase (PF02089.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;