Protein coding transcript 149030

• Transcript: Ll_transcript_29346
• CDS coordinates: 990-1505 (+)
• Peptide sequence: MRLAALGLFLTWRIRHPNHEAMWLWGMSITCELWFAFSWLLDQLPKLCPVNRVTDLSVLKERFESPNLRNPKGRSDLPGIDVFVSTTDPEKEPPFVTANAILPILAVDYPVEKVVYYLSDDGGALLTLEALAETTSFARVWVPFCRKHQIEPRNPEAYFRQSATFSRTRFG*
• ORF Type: complete

Annotations of Ll_transcript_29346

• Blastp: Cellulose synthase-like protein D5 from Arabidopsis with 82.84% of identity
• Blastx: Cellulose synthase-like protein D3 from Arabidopsis with 65.6% of identity
• Eggnog: Glycosyl transferase, family 2(COG1215)
• Kegg: Link to kegg annotations (AT1G02730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020231739.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;