Transcript | Ll_transcript_28633 |
---|---|
CDS coordinates | 108-515 (+) |
Peptide sequence | MKVTWKNNKKKRCLLPLPLFKEKECEDGDEVNVPNTQQPQHQNQSEFEETRHLAKEFQAQGDNLALNGKYREALGKWETAITLAPDIAVLHEQKSQVLLEIGDAWNALKAATRMSCAIFFFIVFISCILHEMLNS* |
ORF Type | complete |
Blastp | Tetratricopeptide repeat protein 33 from Homo with 43.1% of identity |
---|---|
Blastx | Tetratricopeptide repeat protein 33 from Homo with 43.1% of identity |
Eggnog | tetratricopeptide repeat domain 33(ENOG4111N4C) |
Kegg | Link to kegg annotations (23548) |
CantataDB | Link to cantataDB annotations (CNT0001830) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430364.1) |
Pfam | FAT domain (PF02259.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer